PDB entry 1tq2

View 1tq2 on RCSB PDB site
Description: Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases
Class: signaling protein
Keywords: GTPase, Interferon gamma, Crystal structure, dimer, immunology, SIGNALING PROTEIN
Deposited on 2004-06-16, released 2004-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-inducible GTPase
    Species: Mus musculus [TaxId:10090]
    Gene: IIGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ85 (Start-410)
      • cloning artifact (411-414)
    Domains in SCOPe 2.05: d1tq2a_
  • Chain 'B':
    Compound: interferon-inducible GTPase
    Species: Mus musculus [TaxId:10090]
    Gene: IIGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QZ85 (Start-410)
      • cloning artifact (411-414)
    Domains in SCOPe 2.05: d1tq2b_
  • Heterogens: MG, GNP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq2A (A:)
    mgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisd
    alkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnip
    nvvfwdlpgigstnfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyf
    vrtkvdsditneadgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydf
    pvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltf
    lldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiq
    erlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeiclklgrlerph
    rd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq2A (A:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
    nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnea
    dkekvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfm
    vslpnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvf
    gvdetslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyllpk
    nsflkeifylkyyfldmvtedaktllkeiclklgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tq2B (B:)
    mgqlfsspksdenndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisd
    alkeidssvlnvavtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnip
    nvvfwdlpgigstnfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyf
    vrtkvdsditneadgkpqtfdkekvlqdirlncvntfrengiaeppifllsnknvchydf
    pvlmdklisdlpiykrhnfmvslpnitdsviekkrqflkqriwlegfaadlvniipsltf
    lldsdletlkksmkfyrtvfgvdetslqrlardweievdqveamikspavfkptdeetiq
    erlsryiqefclangyllpknsflkeifylkyyfldmvtedaktllkeiclklgrlerph
    rd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq2B (B:)
    ndlpssftgyfkkfntgrkiisqeilnlielrmrkgniqltnsaisdalkeidssvlnva
    vtgetgsgkssfintlrgigneeegaaktgvvevtmerhpykhpnipnvvfwdlpgigst
    nfppdtylekmkfyeydffiiisatrfkkndidiakaismmkkefyfvrtkvdsditnee
    kvlqdirlncvntfrengiaeppifllsnknvchydfpvlmdklisdlpiykrhnfmvsl
    pnitdsviekkrqflkqriwlegfaadlvniipsltflldsdletlkksmkfyrtvfgvd
    etslqrlardweievdqveamikspavfkptdeetiqerlsryiqefclangyllpknsf
    lkeifylkyyfldmvtedaktllkeiclklgr