PDB entry 1tq1

View 1tq1 on RCSB PDB site
Description: Solution structure of At5g66040, a putative protein from Arabidosis Thaliana
Class: structural genomics, unknown function
Keywords: At5g66040, CESG, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-06-16, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: senescence-associated family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39129 (10-128)
      • engineered (68)
    Domains in SCOPe 2.07: d1tq1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq1A (A:)
    mghhhhhhleaeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnr
    gasgmskntdfleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysaw
    aknglptka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq1A (A:)
    aeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmskntd
    fleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka