PDB entry 1tq1

View 1tq1 on RCSB PDB site
Description: solution structure of at5g66040, a putative protein from arabidosis thaliana
Deposited on 2004-06-16, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: NMR5
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tq1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tq1A (A:)
    mghhhhhhleaeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnr
    gasgmskntdfleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysaw
    aknglptka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq1A (A:)
    aeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmskntd
    fleqvsshfgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka