PDB entry 1tq0

View 1tq0 on RCSB PDB site
Description: Crystal structure of the potent anticoagulant thrombin mutant W215A/E217A in free form
Class: blood clotting
Keywords: thrombin, anticoagulant, BLOOD CLOTTING
Deposited on 2004-06-16, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tq0.1
  • Chain 'B':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-256)
      • engineered (226)
      • engineered (228)
    Domains in SCOPe 2.08: d1tq0.1
  • Chain 'C':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tq0.2
  • Chain 'D':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-256)
      • engineered (226)
      • engineered (228)
    Domains in SCOPe 2.08: d1tq0.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tq0A (A:)
    eadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tq0B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfy
    thvfrlkkwiqkvidqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq0B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlkekgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdkygfythvfrlkkwi
    qkvidqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tq0C (C:)
    eadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq0C (C:)
    adcglrplfekksledkterellesyid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tq0D (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfy
    thvfrlkkwiqkvidqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tq0D (D:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlkegqpsvlqvvnlpiverpvckdstriritdnmfca
    gykpkrgdacegdsggpfvmkspfnnrwyqmgivsagagcdrdgkygfythvfrlkkwiq
    kvidqf