PDB entry 1tpt

View 1tpt on RCSB PDB site
Description: three-dimensional structure of thymidine phosphorylase from escherichia coli at 2.8 angstroms resolution
Class: thymidine phosphorylase
Keywords: thymidine phosphorylase
Deposited on 1990-06-14, released 1991-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.28
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tpta1, d1tpta2, d1tpta3
  • Heterogens: SO4, TDR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tptA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise