PDB entry 1tps

View 1tps on RCSB PDB site
Description: atomic structure of the trypsin-a90720a complex: a unified approach to structure and function
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 1994-09-04, released 1995-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpsa_
  • Chain 'B':
    Compound: inhibitor a90720a
    Species: Cyanobacteria [TaxId:1117]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TPS (0-7)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpsA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    No sequence available.