PDB entry 1tpp

View 1tpp on RCSB PDB site
Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, SERINE PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1982-09-27, released 1983-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.191
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tppa_
  • Heterogens: SO4, CA, APA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tppA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn