PDB entry 1tpo

View 1tpo on RCSB PDB site
Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1982-09-27, released 1983-01-18
The last revision prior to the SCOP 1.75 freeze date was dated 1985-03-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-trypsin
  Species: Bos taurus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOP 1.75: d1tpoa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpoA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn