PDB entry 1tpn

View 1tpn on RCSB PDB site
Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance
Class: plasminogen activator
Keywords: plasminogen activator
Deposited on 1993-05-26, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tissue-type plasminogen activator
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00750 (0-49)
  Domains in SCOPe 2.08: d1tpna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpnA (A:)
  syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks