PDB entry 1tpl

View 1tpl on RCSB PDB site
Description: the three-dimensional structure of tyrosine phenol-lyase
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1992-11-25, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.162
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter intermedius [TaxId:66695]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tpla_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter intermedius [TaxId:66695]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tplb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tplA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tplA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    mykngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayiclavtvnlagg
    qpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeivhemfsyad
    gctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmeamaiglrea
    mqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdefpaqslaas
    iyvetgvrsmergikletvrltiprrvytyahmdvvadgiiklyqhkedirglkfiyfft
    arfdyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tplB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tplB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    mygavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayiclavtvnlaggqp
    vsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeivhemfsyadgc
    tmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmeamaiglreamq
    yeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdefpaqslaasiy
    vetgvrsmergikletvrltiprrvytyahmdvvadgiiklyqhkedirglkfiylrfft
    arfdyi