PDB entry 1tpk

View 1tpk on RCSB PDB site
Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution
Deposited on 1991-09-24, released 1992-07-15
The last revision prior to the SCOP 1.57 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1tpka_
  • Chain 'B':
    Domains in SCOP 1.57: d1tpkb_
  • Chain 'C':
    Domains in SCOP 1.57: d1tpkc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkA (A:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkB (B:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkC (C:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst