PDB entry 1tpk

View 1tpk on RCSB PDB site
Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution
Class: plasminogen activator
Keywords: plasminogen activator
Deposited on 1991-09-24, released 1992-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tpka_
  • Chain 'B':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tpkb_
  • Chain 'C':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tpkc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkA (A:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkB (B:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpkC (C:)
    gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
    dgdakpwchvlknrrltweycdvpscst