PDB entry 1tpk

View 1tpk on RCSB PDB site
Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution
Class: plasminogen activator
Keywords: plasminogen activator
Deposited on 1991-09-24, released 1992-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tissue plasminogen activator
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00750 (0-87)
  Domains in SCOPe 2.08: d1tpka_
• Chain 'B':
  Compound: tissue plasminogen activator
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00750 (0-87)
  Domains in SCOPe 2.08: d1tpkb_
• Chain 'C':
  Compound: tissue plasminogen activator
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00750 (0-87)
  Domains in SCOPe 2.08: d1tpkc_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpkA (A:)
  gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
  dgdakpwchvlknrrltweycdvpscst
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpkB (B:)
  gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
  dgdakpwchvlknrrltweycdvpscst
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpkC (C:)
  gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
  dgdakpwchvlknrrltweycdvpscst