PDB entry 1tph

View 1tph on RCSB PDB site
Description: 1.8 angstroms crystal structure of wild type chicken triosephosphate isomerase-phosphoglycolohydroxamate complex
Class: triosephosphate isomerase
Keywords: triosephosphate isomerase
Deposited on 1993-12-22, released 1994-04-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-246)
      • conflict (192)
    Domains in SCOPe 2.01: d1tph1_
  • Chain '2':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-246)
      • conflict (192)
    Domains in SCOPe 2.01: d1tph2_
  • Heterogens: PGH, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1tph1 (1:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tph1 (1:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1tph2 (2:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tph2 (2:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh