PDB entry 1tph

View 1tph on RCSB PDB site
Description: 1.8 angstroms crystal structure of wild type chicken triosephosphate isomerase-phosphoglycolohydroxamate complex
Deposited on 1993-12-22, released 1994-04-30
The last revision prior to the SCOP 1.71 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.71: d1tph1_
  • Chain '2':
    Domains in SCOP 1.71: d1tph2_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1tph1 (1:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tph1 (1:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1tph2 (2:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tph2 (2:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh