PDB entry 1tpg

View 1tpg on RCSB PDB site
Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
Class: plasminogen activation
Keywords: plasminogen activation
Deposited on 1995-06-14, released 1995-09-15
The last revision prior to the SCOP 1.73 freeze date was dated 1995-09-15, with a file datestamp of 2007-06-04.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t-plasminogen activator f1-g
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00750 (0-90)
    • conflict (82)
  Domains in SCOP 1.73: d1tpga1, d1tpga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tpgA (A:)
  syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvkscseprcfngg
  tcqqalyfsdfvcqcpegfagksceidtrat