PDB entry 1tpg

View 1tpg on RCSB PDB site
Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
Deposited on 1995-06-14, released 1995-09-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpg_ (-)
    syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvkscseprcfngg
    tcqqalyfsdfvcqcpegfagksceidtrat