PDB entry 1tpf

View 1tpf on RCSB PDB site
Description: comparison of the structures and the crystal contacts of trypanosomal triosephosphate isomerase in four different crystal forms
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-02-28, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpfa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpfb_
  • Heterogens: DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tpfA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tpfB (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpfB (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq