PDB entry 1tpe

View 1tpe on RCSB PDB site
Description: comparison of the structures and the crystal contacts of trypanosomal triosephosphate isomerase in four different crystal forms
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-02-28, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.155
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tpea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tpeA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpeA (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
    qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq