PDB entry 1tp8

View 1tp8 on RCSB PDB site
Description: crystal structure of a galactose specific lectin from artocarpus hirsuta in complex with methyl-a-d-galactose
Deposited on 2004-06-16, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.193
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tp8.1
  • Chain 'B':
    Domains in SCOP 1.69: d1tp8.1
  • Chain 'C':
    Domains in SCOP 1.69: d1tp8.2
  • Chain 'D':
    Domains in SCOP 1.69: d1tp8.2
  • Chain 'E':
    Domains in SCOP 1.69: d1tp8.3
  • Chain 'F':
    Domains in SCOP 1.69: d1tp8.3
  • Chain 'G':
    Domains in SCOP 1.69: d1tp8.4
  • Chain 'H':
    Domains in SCOP 1.69: d1tp8.4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8A (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tp8B (B:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8B (B:)
    sgksqtvivgpwgakv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8C (C:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tp8D (D:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8D (D:)
    sgksqtvivgpwgakv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8E (E:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tp8F (F:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8F (F:)
    sgksqtvivgpwgakv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8G (G:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tp8H (H:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8H (H:)
    sgksqtvivgpwgakv