PDB entry 1tp8

View 1tp8 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF A GALACTOSE SPECIFIC LECTIN FROM ARTOCARPUS HIRSUTA IN COMPLEX WITH METHYL-a-D-GALACTOSE
Class: sugar binding protein
Keywords: Artocarpus hirsuta, Moraceae plant lectins, Jacalin family, Post-translational modification, Carbohydrate specificity, Methyl--D-galactose, Three-dimensional structure, -prism I fold, SUGAR BINDING PROTEIN
Deposited on 2004-06-16, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin alpha chain
    Species: Artocarpus hirsutus [TaxId:291940]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8 (0-132)
    Domains in SCOPe 2.07: d1tp8.1
  • Chain 'B':
    Compound: agglutinin beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8
    Domains in SCOPe 2.07: d1tp8.1
  • Chain 'C':
    Compound: agglutinin alpha chain
    Species: Artocarpus hirsutus [TaxId:291940]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8 (0-132)
    Domains in SCOPe 2.07: d1tp8.2
  • Chain 'D':
    Compound: agglutinin beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8
    Domains in SCOPe 2.07: d1tp8.2
  • Chain 'E':
    Compound: agglutinin alpha chain
    Species: Artocarpus hirsutus [TaxId:291940]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8 (0-132)
    Domains in SCOPe 2.07: d1tp8.3
  • Chain 'F':
    Compound: agglutinin beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8
    Domains in SCOPe 2.07: d1tp8.3
  • Chain 'G':
    Compound: agglutinin alpha chain
    Species: Artocarpus hirsutus [TaxId:291940]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8 (0-132)
    Domains in SCOPe 2.07: d1tp8.4
  • Chain 'H':
    Compound: agglutinin beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TP8
    Domains in SCOPe 2.07: d1tp8.4
  • Heterogens: AMG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8A (A:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tp8B (B:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8B (B:)
    sgksqtvivgpwgakv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8C (C:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tp8D (D:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8D (D:)
    sgksqtvivgpwgakv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8E (E:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tp8F (F:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8F (F:)
    sgksqtvivgpwgakv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tp8G (G:)
    gkafddgaftgireinlsynketaigdfqvvydlngspyvgqnhssfisgftpvkisldf
    pseyitevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpfnlpienglivgfkgsi
    gywmdyfsmylsl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tp8H (H:)
    densgksqtvivgpwgakvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp8H (H:)
    sgksqtvivgpwgakv