PDB entry 1tp6

View 1tp6 on RCSB PDB site
Description: 1.5 A Crystal Structure of a NTF-2 Like Protein of Unknown Function PA1314 from Pseudomonas aeruginosa
Deposited on 2004-06-15, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tp6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tp6A (A:)
    mtcayrreihhahvairdwlagdsradaldalmarfaedfsmvtphgvvldktalgelfr
    skggtrpglrieidgesllasgvdgatlayreiqsdaagrserlstvvlhrddegrlywr
    hlqetfcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp6A (A:)
    cayrreihhahvairdwlagdsradaldalmarfaedfsmvtphgvvldktalgelfrsk
    ggtrpglrieidgesllasgvdgatlayreiqsdaagrserlstvvlhrddegrlywrhl
    qetfcg