PDB entry 1tp5
View 1tp5 on RCSB PDB site
Description: Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
Class: peptide binding protein
Keywords: PDZ-peptide ligand complex, PEPTIDE BINDING PROTEIN
Deposited on
2004-06-15, released
2005-09-20
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.193
AEROSPACI score: 0.6
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Presynaptic density protein 95
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P31016 (5-105)
- cloning artifact (4)
- cloning artifact (106-118)
Domains in SCOPe 2.03: d1tp5a_ - Chain 'B':
Compound: LYS-LYS-GLU-THR-TRP-VAL peptide ligand
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1tp5A (A:)
gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
Sequence, based on observed residues (ATOM records): (download)
>1tp5A (A:)
flgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqil
svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
- Chain 'B':
No sequence available.