PDB entry 1tp4

View 1tp4 on RCSB PDB site
Description: Solution structure of the XPC binding domain of hHR23A protein
Class: DNA repair
Keywords: DNA repair, NER, XPC, Rad23
Deposited on 2004-06-15, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein rad23 homolog a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD23A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tp4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tp4A (A:)
    gsateaagenpleflrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqf
    iqmlneppgeladisdvegevgaigeeapqmnyiqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tp4A (A:)
    npleflrdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlnepp