PDB entry 1tp0

View 1tp0 on RCSB PDB site
Description: Triple mutation in interleukin 1 beta cavity:replacement of phenylalanines with tryptophan.
Class: immune system
Keywords: hydrophobic cavity, hydrophobicity, IMMUNE SYSTEM
Deposited on 2004-06-15, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-1 beta
  Species: Homo sapiens [TaxId:9606]
  Gene: IL1B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01584 (0-152)
    • engineered (41)
    • engineered (100)
    • engineered (145)
  Domains in SCOPe 2.08: d1tp0a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tp0A (A:)
  apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvwsmsfvqgeesndkipval
  glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvwnkieinnklefesaqfpnw
  yistsqaenmpvflggtkggqditdwtmqfvss