PDB entry 1tow

View 1tow on RCSB PDB site
Description: Crystal structure of human adipocyte fatty acid binding protein in complex with a carboxylic acid ligand
Class: lipid transport
Keywords: Transport, Lipid-binding, LIPID TRANSPORT
Deposited on 2004-06-15, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, adipocyte
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15090 (0-130)
  Domains in SCOPe 2.08: d1towa_
• Heterogens: CRZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1towA (A:)
  cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
  eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
  gvtstrvyera