PDB entry 1tov

View 1tov on RCSB PDB site
Description: Structural genomics of Caenorhabditis elegans: CAP-GLY domain of F53F4.3
Class: structural genomics, unknown function
Keywords: CAP-GLY DOMAIN, CYTOSKELETON, TUBULIN, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2004-06-15, released 2004-07-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.213
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein F53F4.3 in chromosome V
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: F53F4.3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q20728 (0-97)
  Domains in SCOPe 2.05: d1tova_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tovA (A:)
  enesdklneeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkn
  dgsvagvryfdcdpkyggfvrpvdvkvgdfpelsidei