PDB entry 1tot

View 1tot on RCSB PDB site
Description: ZZ Domain of CBP- a Novel Fold for a Protein Interaction Module
Class: transferase
Keywords: Zinc Binding, CBP, TAZ2, TRANSFERASE
Deposited on 2004-06-15, released 2005-01-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tota1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1totA (A:)
gqdrfvytcneckhhvetrwhctvcedydlcincyntkshthkmvkwglgld