PDB entry 1top

View 1top on RCSB PDB site
Description: structure of chicken skeletal muscle troponin-c at 1.78 angstroms resolution
Class: contractile system protein
Keywords: contractile system protein
Deposited on 1993-08-11, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.168
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1topa_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1topA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
    ilratgehvteediedlmkdsdknndgridfdeflkmmegvq