PDB entry 1too

View 1too on RCSB PDB site
Description: Interleukin 1B Mutant F146W
Class: immune system
Keywords: Hydrophobic cavity, Hydrophobicity, IMMUNE SYSTEM
Deposited on 2004-06-14, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01584 (0-152)
      • engineered (145)
    Domains in SCOPe 2.06: d1tooa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tooA (A:)
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdwtmqfvss