PDB entry 1toj

View 1toj on RCSB PDB site
Description: Hydrocinnamic acid-bound structure of SRHEPT mutant of E. coli aspartate aminotransferase
Class: transferase
Keywords: aspartate aminotransferase hexamutant, SRHEPT, TRANSFERASE
Deposited on 2004-06-14, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ASPC, B0928
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-387)
      • engineered (7-8)
      • engineered (29)
      • engineered (103)
      • modified residue (245)
      • engineered (248)
      • engineered (272)
      • engineered (284)
    Domains in SCOPe 2.07: d1toja_
  • Heterogens: HCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tojA (A:)
    mfenitattadpilgladlfraderpgkidlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfalynervgactlvaadsetvdrafgqmkaairanyssppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl