PDB entry 1toe

View 1toe on RCSB PDB site
Description: Unliganded structure of Hexamutant + A293D mutant of E. coli aspartate aminotransferase
Class: transferase
Keywords: aspartate aminotransferase hexamutant, TRANSFERASE
Deposited on 2004-06-14, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ASPC, B0928
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-387)
      • engineered (34)
      • engineered (36)
      • engineered (42)
      • engineered (63)
      • engineered (103)
      • modified residue (245)
      • engineered (280)
      • engineered (284)
    Domains in SCOPe 2.07: d1toea_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1toeA (A:)
    mfenitaapadpilgladlfraderpgkinlgiglyydetgkipvltsvkkaeqyllene
    ttklylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairdnyssppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl