PDB entry 1toa

View 1toa on RCSB PDB site
Description: periplasmic zinc binding protein troa from treponema pallidum
Class: binding protein
Keywords: periplasmic binding protein, zinc binding protein, abc transporter, binding protein
Deposited on 1999-03-03, released 1999-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (periplasmic binding protein troa)
    Species: Treponema pallidum [TaxId:160]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toaa_
  • Chain 'B':
    Compound: protein (periplasmic binding protein troa)
    Species: Treponema pallidum [TaxId:160]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1toab_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1toaA (A:)
    syyhhhhhhdydipttenlyfqgamgsfgskdaaadgkplvvttigmiadavkniaqgdv
    hlkglmgpgvdphlytatagdvewlgnadlilynglhletkmgevfsklrgsrlvvavse
    tipvsqrlsleeaefdphvwfdvklwsysvkavyeslckllpgktreftqryqayqqqld
    kldayvrrkaqslpaerrvlvtahdafgyfsraygfevkglqgvstaseasahdmqelaa
    fiaqrklpaifiessiphknvealrdavqarghvvqiggelfsdamgdagtsegtyvgmv
    thnidtivaalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1toaA (A:)
    gkplvvttigmiadavkniaqgdvhlkglmgpgvdphlytatagdvewlgnadlilyngl
    hletkmgevfsklrgsrlvvavsetipvsqrlsleeaefdphvwfdvklwsysvkavyes
    lckllpgktreftqryqayqqqldkldayvrrkaqslpaerrvlvtahdafgyfsraygf
    evkglqgvstaseasahdmqelaafiaqrklpaifiessiphknvealrdavqarghvvq
    iggelfsdamgdagtsegtyvgmvthnidtivaalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1toaB (B:)
    syyhhhhhhdydipttenlyfqgamgsfgskdaaadgkplvvttigmiadavkniaqgdv
    hlkglmgpgvdphlytatagdvewlgnadlilynglhletkmgevfsklrgsrlvvavse
    tipvsqrlsleeaefdphvwfdvklwsysvkavyeslckllpgktreftqryqayqqqld
    kldayvrrkaqslpaerrvlvtahdafgyfsraygfevkglqgvstaseasahdmqelaa
    fiaqrklpaifiessiphknvealrdavqarghvvqiggelfsdamgdagtsegtyvgmv
    thnidtivaalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1toaB (B:)
    gkplvvttigmiadavkniaqgdvhlkglmgpgvdphlytatagdvewlgnadlilyngl
    hletkmgevfsklrgsrlvvavsetipvsqrlsleeaefdphvwfdvklwsysvkavyes
    lckllpgktreftqryqayqqqldkldayvrrkaqslpaerrvlvtahdafgyfsraygf
    evkglqgvstaseasahdmqelaafiaqrklpaifiessiphknvealrdavqarghvvq
    iggelfsdamgdagtsegtyvgmvthnidtivaalar