PDB entry 1to9

View 1to9 on RCSB PDB site
Description: Crystal structure of THI-4 protein from Bacillus subtilis
Class: biosynthetic protein
Keywords: TenA, Thiamine Biosynthesis, all-alpha, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-06-14, released 2004-08-10
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THI-4 protein
    Species: Bacillus subtilis
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052
      • modified residue (94)
      • modified residue (106)
      • modified residue (139)
      • modified residue (217)
      • modified residue (234)
    Domains in SCOP 1.73: d1to9a_
  • Chain 'B':
    Compound: THI-4 protein
    Species: Bacillus subtilis
    Gene: TENA, BSU11650
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25052 (24-End)
      • cloning artifact (22-23)
      • modified residue (24)
      • modified residue (94)
      • modified residue (106)
      • modified residue (139)
      • see remark 999 (172)
      • modified residue (217)
      • modified residue (234)
    Domains in SCOP 1.73: d1to9b_
  • Heterogens: HMH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1to9A (A:)
    mhhhhhhssgvdlgtenlyfqsnamkfseecrsaaaewwegsfvhpfvqgigdgtlpidr
    fkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaelleis
    eeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpghpiy
    qkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmayrke
    gwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to9A (A:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegwsdsaikev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1to9B (B:)
    mhhhhhhssgvdlgtenlyfqsnamkfseecrsaaaewwegsfvhpfvqgigdgtlpidr
    fkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaelleis
    eeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpghpiy
    qkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmayrke
    gwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to9B (B:)
    namkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfg
    aayakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyr
    svlsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinr
    fdelaensteevrakmkenfvissyyeyqfwgmayrkegwsds