PDB entry 1to5

View 1to5 on RCSB PDB site
Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
Deposited on 2004-06-12, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1to5a_
  • Chain 'B':
    Domains in SCOP 1.69: d1to5b_
  • Chain 'C':
    Domains in SCOP 1.69: d1to5c_
  • Chain 'D':
    Domains in SCOP 1.69: d1to5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to5A (A:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to5B (B:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to5C (C:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to5D (D:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae