PDB entry 1to3

View 1to3 on RCSB PDB site
Description: Structure of yiht from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: beta-alpha barrel, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2004-06-11, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aldolase yihT
    Species: Salmonella typhimurium [TaxId:602]
    Gene: YIHT, STM4022
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L7R9 (3-End)
      • cloning artifact (2)
      • modified residue (19)
      • modified residue (28)
      • modified residue (31)
      • modified residue (87)
      • modified residue (142)
      • modified residue (197)
      • modified residue (221)
      • modified residue (243)
      • modified residue (269)
      • modified residue (288-289)
      • engineered (290)
    Domains in SCOPe 2.07: d1to3a1, d1to3a2
  • Heterogens: PO4, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1to3A (A:)
    mslnnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilsp
    yasavlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrd
    gakalkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaii
    daakelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfprav
    rvameagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkrreggshh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1to3A (A:)
    lnnytikditrasggfamlavdqreamrlmfaaagaktpvadsvltdfkvnaakilspya
    savlldqqfcyrqaveqnavakscamivaaddfipgngipvdnvvldkkinaqavkrdga
    kalkllvlwrsdedaqqrlnmvkefnelchsngllsiiepvvrpprcgdkfdreqaiida
    akelgdsgadlykvemplygkgarsdlltasqrlnghinmpwvilssgvdeklfpravrv
    ameagasgflagravwssviglpdtelmlrdvsapklqrlgeivdemmgkr