PDB entry 1tnx

View 1tnx on RCSB PDB site
Description: nmr solution structure of calcium saturated skeletal muscle troponin c
Class: calcium-binding protein
Keywords: ef-hand, calcium-binding protein
Deposited on 1995-08-23, released 1995-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1tnxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnxA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
    ilratgehvieediedlmkdsdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnxA (A:)
    dqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiiee
    vdedgsgtidfeeflvmmvrqeeelancfrifdknadgfidieelgeilratgehvieed
    iedlmkdsdknndgridfdeflkmm