PDB entry 1tnw

View 1tnw on RCSB PDB site
Description: nmr solution structure of calcium saturated skeletal muscle troponin c
Class: calcium-binding protein
Keywords: ef-hand
Deposited on 1995-08-23, released 1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 1995-10-15, with a file datestamp of 2007-07-20.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tnwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tnwA (A:)
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
ilratgehvieediedlmkdsdknndgridfdeflkmmegvq