PDB entry 1tnu

View 1tnu on RCSB PDB site
Description: Rat Protein Geranylgeranyltransferase Type-I Complexed with a GGPP analog and a GCINCCKVL Peptide Derived from RhoB
Class: Transferase
Keywords: GGTase-I, geranylgeranyltransferase type-I, geranylgeranyl transferase, prenyltransferase, CaaX, Rho, RhoB, Lipid modification, prenylation, substrate selectivity
Deposited on 2004-06-11, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnua_
  • Chain 'B':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnub_
  • Chain 'C':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnuc_
  • Chain 'D':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnud_
  • Chain 'E':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnue_
  • Chain 'F':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnuf_
  • Chain 'G':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnug_
  • Chain 'H':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnuh_
  • Chain 'I':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnui_
  • Chain 'J':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnuj_
  • Chain 'K':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnuk_
  • Chain 'L':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnul_
  • Chain 'M':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Chain 'N':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Chain 'O':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Chain 'P':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Chain 'Q':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Chain 'R':
    Compound: Transforming protein RhoB
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNU (Start-8)
  • Heterogens: ZN, CL, MGM, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnuA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tnuB (B:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuB (B:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tnuC (C:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuC (C:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tnuD (D:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuD (D:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tnuE (E:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuE (E:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tnuF (F:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuF (F:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tnuG (G:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuG (G:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tnuH (H:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuH (H:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tnuI (I:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuI (I:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tnuJ (J:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuJ (J:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tnuK (K:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuK (K:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tnuL (L:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnuL (L:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.