PDB entry 1tnt

View 1tnt on RCSB PDB site
Description: a novel class of winged helix-turn-helix protein: the DNA-binding domain of mu transposase
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1994-10-10, released 1995-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mu-transposase
    Species: Enterobacteria phage Mu [TaxId:10677]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07636 (0-75)
      • conflict (9)
    Domains in SCOPe 2.06: d1tnta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tntA (A:)
    melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
    lllrqgeietslgyfe