PDB entry 1tns

View 1tns on RCSB PDB site
Description: a novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Deposited on 1994-10-10, released 1995-02-14
The last revision prior to the SCOP 1.67 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d1tns__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tns_ (-)
  melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
  lllrqgeietslgyfe