PDB entry 1tnr

View 1tnr on RCSB PDB site
Description: crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex: implications for tnf receptor activation
Class: complex(lymphokine/receptor)
Keywords: complex(lymphokine/receptor)
Deposited on 1994-05-09, released 1994-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.16
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tnra_
  • Chain 'R':
    Compound: tumor necrosis factor receptor p55
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tnrr1, d1tnrr2, d1tnrr3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tnrA (A:)
    kpaahligdpskqnsllwrantdraflqdgfslsnnsllvptsgiyfvysqvvfsgkays
    pkatssplylahevqlfssqypfhvpllssqkmvypglqepwlhsmyhgaafqltqgdql
    sthtdgiphlvlspstvffgafal
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tnrR (R:)
    cpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhclscs
    kcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscqekqn
    tvctchagfflrenecvsc