PDB entry 1tnq

View 1tnq on RCSB PDB site
Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1tnq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tnq_ (-)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda