PDB entry 1tnh

View 1tnh on RCSB PDB site
Description: prediction of novel serine protease inhibitors
Class: HYDROLASE/hydrolase inhibitor
Keywords: HYDROLASE/hydrolase inhibitor complex, SERINE PROTEINASE, TRYPSIN, INHIBITOR - FLUOROBENZYLAMINE
Deposited on 1994-07-21, released 1994-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnha_
  • Heterogens: CA, FBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnhA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnhA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn