PDB entry 1tnf

View 1tnf on RCSB PDB site
Description: the structure of tumor necrosis factor-alpha at 2.6 angstroms resolution. implications for receptor binding
Class: lymphokine
Keywords: lymphokine
Deposited on 1989-08-25, released 1990-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • conflict (44)
    Domains in SCOPe 2.06: d1tnfa_
  • Chain 'B':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • conflict (44)
    Domains in SCOPe 2.06: d1tnfb_
  • Chain 'C':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • conflict (44)
    Domains in SCOPe 2.06: d1tnfc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnfA (A:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnfA (A:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tnfB (B:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnfB (B:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tnfC (C:)
    vrsssrtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfkgqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiyl
    ggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnfC (C:)
    rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
    gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
    lekgdrlsaeinrpdyllfaesgqvyfgiial