PDB entry 1tnb

View 1tnb on RCSB PDB site
Description: Rat Protein Geranylgeranyltransferase Type-I Complexed with a GGPP analog and a substrate KKSKTKCVIF Peptide Derived from TC21
Class: Transferase
Keywords: GGTase-I, geranylgeranyltransferase type-I, geranylgeranyl transferase, prenyltransferase, CaaX, TC21, Lipid modification, prenylation, substrate selectivity
Deposited on 2004-06-11, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.189
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnba_
  • Chain 'B':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbb_
  • Chain 'C':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbc_
  • Chain 'D':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbd_
  • Chain 'E':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbe_
  • Chain 'F':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbf_
  • Chain 'G':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbg_
  • Chain 'H':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbh_
  • Chain 'I':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbi_
  • Chain 'J':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbj_
  • Chain 'K':
    Compound: geranylgeranyltransferase type I alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbk_
  • Chain 'L':
    Compound: Geranylgeranyl transferase type I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tnbl_
  • Chain 'M':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Chain 'N':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Chain 'O':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Chain 'P':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Chain 'Q':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Chain 'R':
    Compound: Fusion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1TNB (Start-9)
  • Heterogens: ZN, CL, MES, MGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tnbA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tnbB (B:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbB (B:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tnbC (C:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbC (C:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tnbD (D:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbD (D:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tnbE (E:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbE (E:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tnbF (F:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbF (F:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tnbG (G:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbG (G:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tnbH (H:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbH (H:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tnbI (I:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbI (I:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tnbJ (J:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbJ (J:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tnbK (K:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbK (K:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tnbL (L:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tnbL (L:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.