PDB entry 1tn9

View 1tn9 on RCSB PDB site
Description: the solution structure of tn916 integrase n-terminal domain/DNA complex
Class: integrase/DNA
Keywords: integrase, DNA binding, transposition, complex, beta-sheet recognition, integrase/DNA complex
Deposited on 1999-01-21, released 1999-09-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (integrase)
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22886 (0-68)
      • mutation (54)
    Domains in SCOPe 2.01: d1tn9a_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*ap*gp*tp*ap*gp*tp*ap*ap*ap*tp*tp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*tp*ap*cp*tp*ap*cp*tp*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tn9A (A:)
    ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdaislre
    kiaelqkdi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.