PDB entry 1tn9

View 1tn9 on RCSB PDB site
Description: the solution structure of tn916 integrase n-terminal domain/dna complex
Deposited on 1999-01-21, released 1999-09-29
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-29, with a file datestamp of 1999-10-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1tn9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tn9A (A:)
    ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdaislre
    kiaelqkdi