PDB entry 1tn5

View 1tn5 on RCSB PDB site
Description: structure of bacterorhodopsin mutant k41p
Deposited on 2004-06-11, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.249
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tn5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1tn5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tn5A (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tn5A (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tn5B (B:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tn5B (B:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg