PDB entry 1tn4

View 1tn4 on RCSB PDB site
Description: four calcium tnc
Class: contractile system protein
Keywords: contractile system protein, calcium regulation, calmodulin superfamily
Deposited on 1997-09-18, released 1998-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02586 (0-End)
      • engineered (97)
    Domains in SCOPe 2.04: d1tn4a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tn4A (A:)
    tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
    evdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifr
    asgehvtdeeieslmkdgdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tn4A (A:)
    tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
    evdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifr
    asgehvtdeeieslmkdgdknndgridfdeflkmmeg