PDB entry 1tn3

View 1tn3 on RCSB PDB site
Description: the c-type lectin carbohydrate recognition domain of human tetranectin
Deposited on 1997-11-06, released 1998-05-06
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1tn3__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tn3_ (-)
    alqtvclkgtkvhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsv
    gneaeiwlglndmaaegtwvdmtgariayknweteitaqpdggktencavlsgaangkwf
    dkrcrdqlpyicqfgiv